PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 158aa    MW: 18036.5 Da    PI: 10.2041
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006021genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP92.31e-2871137369
                   TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssss 69 
                           +++++ ski T++g+RdRR+Rls+  a++fFdLq+ LGfdk+skti+WL++ ++ a  elt+ s+ +
  PGSC0003DMP400006021  71 KRERSCSKILTAQGPRDRRIRLSIAMARKFFDLQELLGFDKPSKTIDWLFTHSQVALEELTNWSTHQ 137
                           577888*******************************************************985554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.10171130IPR017887Transcription factor TCP subgroup
PfamPF036341.3E-2777136IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MFSASNSSTH DNPLPQYISS SFHTSSPFVG LNGNQILLHQ YYQNQFSSHY LAKNNCVDSL  60
RSFPMKKKPK KRERSCSKIL TAQGPRDRRI RLSIAMARKF FDLQELLGFD KPSKTIDWLF  120
THSQVALEEL TNWSTHQTQI SGLILALTII KYQNEPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-168HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069311.11e-83PREDICTED: transcription factor CYCLOIDEA-like isoform X1
RefseqXP_015069312.11e-83PREDICTED: transcription factor CYCLOIDEA-like isoform X2
SwissprotO492505e-31CYCLD_ANTMA; Transcription factor CYCLOIDEA
SwissprotQ9SBV64e-31CYCLD_ANTML; Transcription factor CYCLOIDEA (Fragment)
SwissprotQ9SBV94e-31CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBLM0ZUX31e-115M0ZUX3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000086731e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43332244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.19e-24TCP domain protein 12
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]